2008-07-18 Swhack IRC Log

00:12:14 *** ejot has quit ("Leaving")
00:13:24 <kpreid> phenny: tell Arnia from #haskell: <BMeph> Haskell: Where even the newest newcomer acts monadically: join :: ask (ask something) -> ask something
00:13:24 <phenny> kpreid: I'll pass that on when Arnia is around.
00:13:37 *** lordi has quit (Remote closed the connection)
00:13:56 <aspect> kpreid: :-)
00:25:25 *** cskaterun (n=cskateru@cpe-24-30-130-132.san.res.rr.com) has joined #swhack
01:05:59 * jessica returns from hours of messing about with nickserv.
01:06:04 <jessica> I never knew it could be such fun.
01:10:12 <jsled> oh?
01:10:25 <jsled> exploiting something, I hope.
01:22:24 *** d8uv (i=45b205b4@gateway/web/ajax/mibbit.com/x-c45deb470e4d4bd6) has joined #swhack
01:23:16 <d8uv> ...
01:35:16 *** [PLACEHOLDER] has quit (Read error: 110 (Connection timed out))
01:38:57 *** FocusLocus has quit ("This computer has narcol..zzzzZZZ")
01:43:01 *** zachc (i=4c76cb46@gateway/web/ajax/mibbit.com/x-ebb67c347b9411c1) has joined #swhack
01:43:08 <zachc> Ello
01:45:08 <d8uv> So
01:45:18 <d8uv> My ethics teacher is crazy smart
01:46:06 <zachc> Most profs are, no?
01:48:04 <zachc> Hmm, I was thinking about IRC as a protocol
01:48:15 <zachc> and using it to do other things, taking something from Bitlbee...
01:48:29 <zachc> crazy thoughts...
01:49:10 <aspect> I'm using irc to prototype a board game at the moment
01:49:52 <zachc> how so?
01:50:18 <aspect> it's just convenient to use an irc library in $language_of_choice and have all comms go on in a channel for interactive debugging; at some later stage parts of the comms will go private and then I'll write proper networking into the server and clients
01:50:57 <zachc> oh, so its a network game
01:51:17 <aspect> yep. irc's just a convenient medium for prototyping the networking
01:51:20 <zachc> i was thinking about writing/modifying a server
01:52:02 <aspect> ah; different story. I don't know about bitlbee but jabber has an irc server module also
01:52:41 <zachc> yeah, bitlbee appears to modify the way rooms work, if you join a room, only you and whomever you're talking to is in there
01:52:52 <zachc> even if other people are on #dude
01:53:04 <zachc> understand what I mean?
01:53:38 <zachc> s/room/channel/
01:54:18 <jsled> aspect: yeah, people using XMPP in a similar way ... I guess you'd want XMPP + group-chat, so you can easily observe and interact.
01:54:27 <jsled> Or MUC or whatever they call it.
02:22:23 * zachc shrugs
02:26:04 *** martiancode has quit (Remote closed the connection)
02:44:50 *** panni_ has quit ("( www.nnscript.de :: NoNameScript 3.81 :: www.XLhost.de )")
02:57:32 <zachc> ...
03:09:18 *** zachc has quit ("http://www.mibbit.com ajax IRC Client")
03:26:08 *** Schroeder (i=1000@unaffiliated/unclejimbob) has joined #swhack
03:37:32 *** d8uv has quit ("http://www.mibbit.com ajax IRC Client")
03:55:49 <Morbus> phenny, tell jsled 10 to 9 ;) (though, it was an easy one; i'm also thinking this co-op thing is local only)
03:55:50 <phenny> Morbus: I'll pass that on when jsled is around.
04:01:35 *** MacTed (n=Thud@twentyfourmullen.hsd1.ma.comcast.net) has joined #swhack
04:03:07 <jsled> Morbus: nope. 12 to 11. :)
04:03:07 <phenny> jsled: 03:55Z <Morbus> tell jsled 10 to 9 ;) (though, it was an easy one; i'm also thinking this co-op thing is local only)
04:16:18 <jsled> Morbus: 12 to 11. ;) And, yeah, no online coop c.f. http://boardsus.playstation.com/playstation/board/message?board.id=ps3dlgames&message.id=93632#U36885320
04:16:22 <jsled> Grr.
04:16:35 <jsled> phenny: tell Morbus 12 to 11. ;) And, yeah, no online coop c.f. http://boardsus.playstation.com/playstation/board/message?board.id=ps3dlgames&message.id=93632#U36885320
04:16:35 <phenny> jsled: I'll pass that on when Morbus is around.
04:16:47 <jsled> spam(sorry).
04:19:29 *** Schroeder2 (i=1000@unaffiliated/unclejimbob) has joined #swhack
04:20:39 *** Schroeder has quit (Read error: 110 (Connection timed out))
04:21:10 <aspect> .ety fob
04:21:11 <phenny> "1653, 'small pocket for valuables,' probably related to Low Ger. fobke 'pocket,' High Ger. fuppe 'pocket.' Meaning 'chain attached to a watch carried in the fob' is from 1885." - http://etymonline.com/?term=fob
04:45:28 *** Schroeder2 has quit (Read error: 110 (Connection timed out))
04:54:05 <jsled> huh. I always wondered where that came from.
04:54:38 <jsled> http://emacs.wordpress.com/2008/07/17/org-from-the-horses-mouth/ was interesting, and certainly showed me a couple of desirable things I didn't know about, and I've been using org-mode for a couple of years now!
04:55:03 <jsled> But it's a talk about an emacs mode, and he doesn't show which keybindings (or function names) achieve the desired results.
04:55:10 <jsled> So, it's basically a scavenger hunt.
04:55:25 <jsled> I have enough puzzles, kthx.
04:55:32 <jsled> Don't you, Monty?
04:55:37 <Monty> huh. I ponder... It'll give me your editing or compose,' from M.L. Burgundia, from dental records.
05:10:13 *** MacTed has quit (simmons.freenode.net irc.freenode.net)
05:10:13 *** procto has quit (simmons.freenode.net irc.freenode.net)
05:10:13 *** tro has quit (simmons.freenode.net irc.freenode.net)
05:12:26 *** MacTed (n=Thud@twentyfourmullen.hsd1.ma.comcast.net) has joined #swhack
05:12:26 *** procto (n=boo@logarchy.org) has joined #swhack
05:12:26 *** tro (i=trotek@k.thnx.org) has joined #swhack
05:12:33 *** procto has quit (Connection reset by peer)
05:12:33 *** procto_ (n=boo@logarchy.org) has joined #swhack
05:49:28 *** jetscreamer (n=jetscrea@unaffiliated/jetscreamer) has joined #swhack
06:09:50 *** mmmmmrob (n=mmmmmrob@82-36-211-60.cable.ubr04.king.blueyonder.co.uk) has joined #swhack
06:23:28 *** cskaterun has quit ()
06:29:24 *** mmmmmrob has quit ()
06:35:47 <xover> phenny: tell nslater http://www.fsf.org/blogs/community/5-reasons-to-avoid-iphone-3g
06:35:48 <phenny> xover: I'll pass that on when nslater is around.
06:45:53 *** danja (n=danny@host47-20-dynamic.9-79-r.retail.telecomitalia.it) has joined #swhack
07:12:49 *** libby (n=libby@92.237.82.160) has joined #swhack
07:23:38 *** mmmmmrob (n=mmmmmrob@62.172.77.66) has joined #swhack
07:34:43 *** danja has quit (Read error: 110 (Connection timed out))
07:58:41 *** BigJibby has quit (Read error: 113 (No route to host))
07:59:43 *** BigJibby (n=matt@142.46.8.22) has joined #swhack
08:14:31 *** danja (n=danny@host57-52-dynamic.36-79-r.retail.telecomitalia.it) has joined #swhack
08:14:45 *** cre8radix (n=cre8radi@p54BE4D8F.dip.t-dialin.net) has joined #swhack
08:20:24 *** BigJibby has quit (Read error: 113 (No route to host))
08:35:47 *** Louie` (n=louie@unaffiliated/louie/x-000001) has joined #swhack
08:37:44 <sbp> yo
08:42:05 <Louie`> yo
08:43:08 <Louie`> Im stuck coding some whois script for phenny, Im not sure how to do check the input for a correct http://-address and make phenny take the whole address
08:44:02 *** idickinson (n=ijd@88-108-133-68.dynamic.dsl.as9105.com) has joined #swhack
08:44:02 <Monty> But what does idickinson have to do with the price of fish?
08:50:58 *** [PLACEHOLDER] (n=nsh@eduroam-80.uta.fi) has joined #swhack
08:53:19 <sbp> [[[
08:53:20 <sbp> The site of the ancient hippodrome course in Olympia, where the emperor Nero competed for Olympian laurels, has been discovered.
08:53:24 <sbp> ]]] - http://www.sciencedaily.com/releases/2008/07/080714145253.htm
08:55:30 <sbp> .title http://www.roswell-record.com/print.asp?SectionID=49&SubSectionID=112&ArticleID=29836
08:55:31 <phenny> sbp: Roswell Daily Record | Strange rock raises questions
08:56:06 <sbp> .title http://www.theregister.co.uk/2008/07/11/lithuanian_shed_shocker/
08:56:07 <phenny> sbp: Woman finds Lithuanian living in shed | The Register
08:57:25 <sbp> .title http://mysterytopia.com/2008/07/odd-fish-contradicts-intelligent-design.html
08:57:27 <phenny> sbp: Mysterytopia: Odd fish contradicts intelligent-design argument
09:00:53 <[PLACEHOLDER]> "argument", you keep using that word...
09:00:55 *** [PLACEHOLDER] is now known as nsh
09:07:24 <sbp> [[[
09:07:25 <sbp> The Salutation and Cat. The 'Salutation' (which refers to the angel saluting the Virgin Mary) is the sign of the house and the 'Cat' is added to signify that arrangements are made for playing cat or tipcat.
09:07:30 <sbp> ]]] - http://www.probertencyclopaedia.com/cgi-bin/res.pl?keyword=Cat+and+Fiddle&offset=0
09:07:36 <sbp> .wik Tipcat
09:07:39 <phenny> "Tip-cat (also called Cat, Cat and Dog, One-a-cat) is a pastime which consists of tapping with a stick a short billet of wood with sharpened ends upon one of these ends, so that it jumps in the air, and then hitting it to the greatest possible distance." - http://en.wikipedia.org/wiki/Tipcat
09:07:55 <nsh> awesome
09:17:43 *** danja has quit (Read error: 110 (Connection timed out))
09:18:06 *** mmmmmrob_ (n=mmmmmrob@62.172.77.66) has joined #swhack
09:19:11 *** danieljohnlewis (n=danieljo@82.46.89.37) has joined #swhack
09:24:55 <cre8radix> moin:zen
09:25:15 *** cre8radix has quit ("your mama! >:)")
09:25:22 *** cre8radix (n=cre8radi@p54BE4D8F.dip.t-dialin.net) has joined #swhack
09:25:22 <Monty> hi cre8radix, how ya doing?
09:25:41 <cre8radix> aight, monty... thx
09:25:42 <Monty> DUDE!
09:34:25 *** mmmmmrob has quit (Read error: 110 (Connection timed out))
10:17:00 <cre8radix> wow
10:17:04 <cre8radix> slow day ey?
10:17:08 <sbp> yeah
10:17:22 <cre8radix> SBP!
10:17:24 <cre8radix> :D
10:17:25 <sbp> YO
10:17:31 <sbp> what ups?
10:17:32 * cre8radix was in wroclaw
10:17:35 <sbp> ooh
10:17:41 <cre8radix> 'Twas cool
10:17:49 <cre8radix> polish peepz are nice
10:18:04 <sbp> what the haps there?
10:18:15 <cre8radix> when i came back to berlin, i was like...
10:18:18 <cre8radix> omg
10:18:22 <cre8radix> zombies
10:18:25 <sbp> hehe
10:18:34 * cre8radix attended a festival
10:19:01 <cre8radix> we did a tour through the center of wroclaw
10:19:12 <cre8radix> wearing wireless headphones
10:19:26 <cre8radix> i was rappin freestyle about what we saw
10:19:27 <sbp> neisch
10:19:38 <cre8radix> ca. 50 people
10:19:48 <sbp> BOOM SHAKALAK BOOM SHAKALAK THERE'S A DUDE IN A FROCK
10:21:43 <cre8radix> hrhr
10:21:52 * cre8radix goes to buy a record
10:21:56 <cre8radix> l8r bro
10:22:00 <sbp> c'yaz
10:33:26 *** d3llboy has quit (Remote closed the connection)
10:38:02 *** d3llboy (i=d3llboy@gateway/tor/x-97e1ab7d4613a44d) has joined #swhack
10:47:20 *** idickinson1 (n=ijd@nat/hp/x-dc439061b92343eb) has joined #swhack
10:47:40 *** idickinson1 has quit (Client Quit)
10:56:48 <jessica> y'all, what's the point of Pibb?
10:57:01 <jessica> it's like academic folk telling me FirstClass is the shiznit.
10:57:14 <jessica> Pibb is broken IRC just as FirstClass and all bulletin board systems are broken USENET.
11:12:55 *** jessica has quit ("The computer fell asleep")
11:17:43 *** chris2 (n=chris@p5B16AD57.dip0.t-ipconnect.de) has joined #swhack
11:26:53 *** jessica (n=jpallan@66.92.66.26) has joined #swhack
11:26:55 <Morbus> jsled: ooh, which one did you pick up? i've been wokring on 10x, 5 shields, and 7 minutes.
11:26:55 <phenny> Morbus: 04:16Z <jsled> tell Morbus 12 to 11. ;) And, yeah, no online coop c.f. http://boardsus.playstation.com/playstation/board/message?board.id=ps3dlgames&message.id=93632#U36885320
11:30:21 *** kpreid has quit ()
11:30:49 *** kpreid (n=kpreid@cpe-67-242-12-135.twcny.res.rr.com) has joined #swhack
11:33:24 <nsh> .wik Pibb
11:33:25 <phenny> "Pibb Xtra (previously sold as Mr. PiBB) is a carbonated soft drink marketed by The Coca-Cola Company." - http://en.wikipedia.org/wiki/Pibb
11:33:45 <melbel> Mr PiBB :D
11:34:02 <nsh> sounds like tastemargh
11:36:54 <nsh> .ety segue
11:37:00 <phenny> "1740, an instruction in musical scores, from It. segue, lit. 'now follows,' meaning to play into the following movement without a break, third person sing. of seguire 'to follow,' from L. sequi 'to follow,' from PIE *sekw- 'to follow' (see sequel)." - http://etymonline.com/?term=segue
11:42:05 <procto_> wooo bus irc
11:43:06 <procto_> wifi on busses. the way travel should be
11:43:06 <Monty> http://flickr.com/photos/leahbuechley/2675056150/in/photostream/
11:54:17 *** panni_ (i=hannes@ip-88-152-22-213.hsi.ish.de) has joined #swhack
12:02:07 <nslater> xover: thanks for the link, already seen it though :p
12:03:02 <nslater> oh wow...
12:03:14 <nslater> ... I have an email from Paul Ginsparg this morning
12:11:02 <nslater> lisppaste2: url
12:11:02 <lisppaste2> To use the lisppaste bot, visit http://paste.lisp.org/new/swhack and enter your paste.
12:11:38 <lisppaste2> nslater pasted "Paul Ginsparg's thoughts on Ginsparg's Law" at http://paste.lisp.org/display/63887
12:11:53 <nslater> loggy: url
12:12:19 <nslater> phenny: tell sbp http://swhack.com/logs/2008-07-18#T12-03-02
12:12:19 <phenny> nslater: I'll pass that on when sbp is around.
12:19:59 <nslater> phenny: tell sbp I've updated /miscellanea/ginsparg to mention the blessing
12:19:59 <phenny> nslater: I'll pass that on when sbp is around.
12:20:04 * nslater grins
12:21:05 <nslater> so, someone needs to make a wikipedia page, or at least update Ginsparg's article, not sure one citation really counts though ;)
12:21:38 <sbp> nslater: hmm!
12:21:42 <sbp> awesome
12:21:45 <nslater> totally
12:29:19 *** panni_ has quit ("( www.nnscript.de :: NoNameScript 3.81 :: www.XLhost.de )")
12:34:10 *** MacTed has quit ()
12:36:21 * Arnia grumbles over the hijacking of the term 'intelligent design'
12:36:21 <phenny> Arnia: 00:13Z <kpreid> tell Arnia from #haskell: <BMeph> Haskell: Where even the newest newcomer acts monadically: join :: ask (ask something) -> ask something
12:36:31 <Arnia> Very vexing to a deist
12:38:17 <kpreid> <joke about deixis>
12:39:16 <Arnia> <insert joke here>
12:39:34 <kpreid> <"<insert here>" joke>
12:39:36 <Monty> FISH
12:39:36 <Arnia> Which is possibly the most contrived joke I've ever made :/
12:39:51 <Arnia> INDEED
12:40:04 <kpreid> In word?
12:40:08 * Arnia thinks about functors some more
12:40:37 * kpreid imagines category theory taught in the style of Schoolhouse Rock
12:41:27 <Arnia> -^\circ : C -> Hom(C) \times Hom(C)
12:42:08 <kpreid> What's -^ asciifying?
12:42:31 <jsled> Morbus: I got 10x and 5 shields.
12:42:32 <Arnia> A^\circ = <Hom(-,A), Hom(A,-)>
12:42:45 <Morbus> jsled: ah, nice. nearest i've gotten is 9x at the moment.
12:42:54 <Morbus> nearly there.
12:43:09 <jsled> Yeah ... it plateaued on 9x for an annoyingly long time.
12:43:53 <nslater> FISH
12:43:56 <Arnia> g : A -> B => g^\circ = \(f,h) -> (g.f, h.g)
12:44:07 <jsled> (FISH)
12:44:25 <Arnia> hrm. Flip those round actually
12:44:25 <nslater> Morbus: recomend me a new game for the ps3 pls (or jsled)
12:44:34 <nslater> preferably something I'm not going to give up like MGS
12:44:38 <Morbus> resistance, fall of man.
12:44:47 <Morbus> then we'll play the sequel together and get trophies.
12:44:48 <Morbus> ;)
12:44:50 <nslater> FPS?
12:44:51 <jsled> :)
12:44:53 <nslater> does it have bosses?
12:44:57 <Morbus> y
12:44:58 <Arnia> Oh, no... leave as is
12:44:59 <nslater> ugh
12:45:07 * Arnia checks his types IRC style
12:45:08 <nslater> bosses are so 1999
12:45:23 * nslater cant wait for the next COD
12:45:35 <Arnia> kpreid: -^ is a dash (placeholder term) with a superscript
12:46:03 <kpreid> oh, so -° roughly? ok
12:46:09 <Arnia> Yeah
12:46:31 <Arnia> I'm thinking of calling this the composition-point functor
12:47:09 <Arnia> Since it basically reifies the condition of composition; taking each object to all those morphisms coming in and all those coming out
12:47:28 * Arnia is still trying to categorify NAL
12:48:43 <MoiraA> morning
12:48:57 <Arnia> id° = \(f,h) -> (id.f, h.id) = \(f,h) -> (f,h) = id
12:49:10 <MoiraA> quite Arnia
12:49:15 <MoiraA> totally agree
12:49:47 <jsled> nslater: And you thought Uncharted was shit, correct? Which means you've already played it, then. :)
12:51:24 * Arnia puzzles
12:51:37 <Arnia> I need paper to work out whether -° preserves composition
12:51:55 <Arnia> (that is whether gf° = g°f°)
12:54:38 <Arnia> uh, assuming composition binds more tightly than functor application here
12:55:11 <nslater> kpreid: Uncharted is shite, yes
12:55:13 <nslater> erm
12:55:16 <nslater> jsled: ^^
12:55:19 <nslater> kpreid: ignore me
12:55:24 <kpreid> /ignore nslater
12:55:29 <nslater> : : : ( ( (
12:55:45 <kpreid> Arnia: paper? bah!
12:56:13 <sbp> paper
12:56:16 <Monty> I chose scissors - I win! :o)
12:56:24 *** MoiraA has quit (Client Quit)
12:57:48 <Arnia> Ok... given m : A -> B and n : B -> C, mn° : Hom(-,A) x Hom(A,-) -> Hom(-,C) x Hom(C,-)
12:59:37 <jsled> nslater: Have you played super star dust hd?
13:03:11 <Arnia> Given f : X -> A, g : A -> B, h : B -> C, i : C -> Y, nm° = \(f,g) -> ((n.m).f, g.(n.m)) according to definition. But it can't
13:03:19 <Arnia> So -° can't be a functor
13:03:20 <Arnia> Bugger
13:03:21 <nslater> jsled: yes and completed it, im not a trophy whore though
13:03:44 <nslater> rock
13:03:47 <nslater> stone
13:03:48 <Monty> I chose scissors - You win :(
13:03:58 <nslater> IN YO FACE MONTYKINS
13:03:59 <Monty> (happens)
13:04:07 <nslater> (FACT)
13:05:05 <Arnia> Things labelled with (FACT) are false (FACT)
13:05:20 * Arnia watches (FACT) explode with some satisfaction
13:05:35 <Arnia> I had to paradox my way out of a very similar situation once.
13:06:45 <nslater> oh shit, you just dumped the whole channel into tumbolia
13:06:48 <nslater> nice one Arnia
13:07:00 <nslater> lucky I brought my popping potion with me today
13:07:02 <nslater> *pop*
13:07:32 <Arnia> nslater appears to have turned into a cloud of bubbles
13:07:38 * Arnia tastes one
13:07:44 <Arnia> Loganberry
13:07:53 <nslater> hah, sweet
13:07:55 * nslater licks self
13:08:59 <Arnia> plz b not paradocking teh intarwebs
13:09:08 <Arnia> .gc paradocks
13:09:09 <phenny> paradocks: 660
13:09:24 <Arnia> Quick! We need five more hits
13:10:20 * nslater adds note about pushing/popping to http://en.wikipedia.org/wiki/Tumbolia
13:12:53 <Arnia> The idea of layered systems is actually quite important in semantics
13:13:22 <Arnia> Gödel's first incompleteness theorem
13:13:38 <nslater> he had a second?
13:14:25 <clsn> No, it was incomplete.
13:14:38 <nslater> dudum tsh
13:15:48 <clsn> Thank you.
13:17:43 <Arnia> nslater: yes, he had two incompleteness theorems
13:18:05 <kpreid> Arnia: Faré Rideau's thesis argues that "meta" is a bad metaphor -- that the meta-system should be thought of as *below*, not *above*
13:18:18 <Arnia> kpreid: hm?
13:18:54 <kpreid> Oh, probably irrelevant, but you made me think of it
13:19:01 <Arnia> I tend to visualise it in terms of power... so the system which describes a system will be above
13:19:17 <Arnia> (under UP-IS-MORE as a generalised metaphor)
13:19:40 <Arnia> I suppose he views it more as 'foundations'
13:19:44 <kpreid> He speaks of one system implemented in terms of another, on top of another. foundation, support, yes...
13:19:51 <kpreid> I think you might like to read it, actually
13:19:57 <Arnia> How static ;)
13:20:36 <nslater> im sure the directional metaphore is largely unimportant, even if you described it as slightly to the left and a bit wonkey, it doesnt affect it's consiquences
13:20:41 <Arnia> kpreid: do you have a reference?
13:20:49 <Arnia> nslater: it colours your thoughts
13:20:56 <kpreid> Arnia: mm, not so much. I'd say more but I don't recall the details
13:21:22 <nslater> Arnia: in that case, it should be above because that's, I presume, the natural conotation (compare heaven and hell)
13:21:42 <kpreid> Arnia: digging up.
13:21:47 <kpreid> Hmm, maybe it's not a thesis
13:23:24 <kpreid> Arnia: Ah, found it. http://fare.tunes.org/tmp/ (I had forgotten about the oddball license)
13:27:27 <Arnia> danke
13:27:31 * Arnia considers sub-distributivity some more
13:29:43 * nsh is dubious
13:30:05 <nslater> your face is dubious
13:31:51 <Arnia> aha
13:31:57 * Arnia defines a lattice
13:32:16 *** melbel has quit (Read error: 104 (Connection reset by peer))
13:33:02 *** MacTed (n=Thud@63.119.36.36) has joined #swhack
13:35:05 <Arnia> Essentially, use powersets rather than sets of morphisms and map each morphism to the appropriate ordering
13:35:16 * Arnia needs to clarify things to himself a bit first and shuts up
13:46:32 *** MoiraA (i=moira@tor/regular/pdpc.supporter.active.MoiraA) has joined #swhack
14:26:34 *** d3llboy_ (i=d3llboy@gateway/tor/x-d0b4480d7c111ebf) has joined #swhack
14:27:22 <nsh> nslater, Feynmann is stalking you through the:
14:27:23 <nsh> .wik Baader-Meinhof_Phenomenon
14:27:23 <phenny> "The Baader-Meinhof Phenomenon occurs when a person, after having learned some (usually obscure) fact, word, phrase, or other item for the first time, encounters that item again, perhaps several times, shortly after having learned it." - http://en.wikipedia.org/wiki/Baader-Meinhof_Phenomenon
14:27:56 <sbp> !!
14:27:58 <sbp> thanks!
14:27:59 <nsh> as a result of the:
14:28:02 <nsh> .wik Recency effect
14:28:02 <phenny> "The serial position effect refers to the finding that recall accuracy varies as a function of an item's position within a study list." - http://en.wikipedia.org/wiki/Recency_effect
14:28:07 <sbp> I saw that on a mailing list once
14:28:10 <sbp> in like 2002
14:28:12 <nsh> cool
14:28:16 <sbp> and have been searching for it ever since
14:28:22 <sbp> often asked various people when it's come up
14:28:39 <MoiraA> morning sbp
14:28:40 <nsh> sweet. thank http://www.reddit.com/info/6sc37
14:29:12 <nsh> rofl: first comment about the Baader-Meinhof Phenomenon in that thread:
14:29:18 * MoiraA feels ignored
14:29:20 <nsh> [[[
14:29:20 <nsh> my ex-girlfriend had the same phenomenon... right after we split up, she swore she saw me - or someone who looked a lot like me - in the bus on her way to work, or walking down her street, shopping at the grocery store, etc.
14:29:21 <nsh> It wasn't until a few weeks later that I was finally arrested on stalking charges.
14:29:22 <nsh> ]]]
14:29:39 <nsh> +++
14:30:02 <sbp> hmm. but when was this coined? I can't find evidence
14:30:04 <sbp> MoiraA: hey
14:30:34 <MoiraA> I'm invisible today
14:30:38 <MoiraA> freenode help ignore me
14:30:39 <sbp> if it was coined after I read about it on the mailing list, then there's some other term for it floating about out there
14:30:47 <MoiraA> ah, I was getting worreid
14:30:48 <sbp> MoiraA: 'k
14:31:14 <MoiraA> its just that every single channel hasn't acknowledged me
14:31:18 <nsh> sbp, might have to check the bulletin board archives
14:31:33 <sbp> nsh: I was going to, but then figured I couldn't be bothered to wade through it
14:31:41 <nsh> yeah, me toox0r
14:32:22 <sbp> I see it in blogs going back to 2006 at least
14:32:41 <sbp> "Wow, I just heard of the Baader-Meinhof phenomenon the other day, and now it's cropping up everywhere! posted by kindall at 8:04 PM on March 29, 2005 ..."
14:33:07 <sbp> 'I'm pretty sure my blog post in May of 2001 is the first online chronicling of the term "Baader-Meinhof Phenomenon". posted by norm at 1:18 PM on February ...'
14:33:09 <nsh> http://hobbsblog.8m.com/2001/05/baader-meinhof-there-is-long-running.html
14:33:28 <sbp> aye
14:33:30 <nsh> that was posted in may 2001, when [purportedly] there were only two hits for the phrase
14:33:31 *** MoiraA changed the topic to: "<nsh> NO SHOOT MAH MOONOSAURI! | Do not use Orange network! Their customer service stinks"
14:33:32 <sbp> so there we have it
14:33:44 <nslater> hmm
14:33:49 <sbp> sounds potentially the right one
14:34:24 <sbp> MoiraA: are we invisible to you?
14:34:35 * nsh first thought about it at the tender age of 7/8
14:34:48 <nsh> after playing some board game
14:35:00 <sbp> Ludo?
14:35:02 <nslater> oh man, feynman popped up in a talk by richard dawkins i was watching last night
14:35:05 <nslater> I almost screamed
14:35:06 <MoiraA> oh, just recently then?
14:35:16 <Noia> ...
14:35:21 <MoiraA> you wimp
14:35:24 <nsh> nah, it was some game with a board and cards and i remember the word 'Tiger' had something to do with it
14:35:25 <MoiraA> woos
14:35:28 <nslater> also, has anyone been to any of the christmas lectures?
14:35:28 <MoiraA> hi Noia
14:35:35 <nslater> ... I wonder how hard it is to get tickets
14:35:36 <nsh> wait
14:35:37 <nsh> it was
14:35:41 <nsh> something to do with dares
14:35:50 <nsh> i remember a ketchup sandwich being involved
14:36:08 *** BigJibby (n=matt@142.46.8.22) has joined #swhack
14:36:10 <sbp> first result for [board card game tiger]:
14:36:10 <sbp> World of Warcraft Trading Card Game - Spectral Tiger Card
14:36:40 <MoiraA> no sbp, I think I am invisible to everyone
14:36:51 <MoiraA> ie on ignore across the whole irc network
14:37:11 <sbp> I mean you seem to be paying as little interest in our subjects as we are in yours
14:38:14 <MoiraA> I'm just in a bad mood sbp
14:38:15 <MoiraA> sorry
14:38:16 <MoiraA> Orange have given me a complete runaround
14:38:19 <nslater> sbp++
14:38:48 <MoiraA> anyone handy is likely to get the backlash :) which is no wonder people are avoiding me lol
14:39:47 <nslater> MoiraA: I think you're suffering from paranoid delusions... most people ignore my ramblings in her but I long since stopped taking it personally
14:40:03 <nslater> *here (strange concept)
14:40:20 <MoiraA> no I think I'm just looking for a fight
14:40:22 <MoiraA> :)
14:40:25 <MoiraA> sorry
14:40:26 <nslater> MoiraA: see above question about the christmas lecutres that NO ONE ANSERED!
14:40:44 <sbp> I was going to mention that nsh and I listened to Bertrand Russell's Reith lecture once
14:40:49 <MoiraA> yeah I'm being pathetic
14:40:55 <sbp> but that seemed sorta too besides the point to mention
14:40:59 <nsh> was tres magnificent!
14:41:00 <MoiraA> I used to listen to those regularly
14:41:01 <nslater> sbp, what, in person?
14:41:05 <sbp> so I didn't. until now, to illustrate was I wasn't going to say
14:41:07 <MoiraA> they were usually very interesting
14:41:12 <sbp> heh, no, it's on bbc.co.uk or something
14:41:21 <nslater> well, I want to go to the christmas lectures this year, would be radcool
14:41:29 <nslater> do they still do them? dont watch tv lolololol
14:41:35 <sbp> 13:50:40 * nsh listens to Bertrand Russell's 1948 Reith lecture
14:41:35 <sbp> 13:51:25 <nsh> .. and laments that such a man not be with us in these times
14:41:35 <sbp> 13:57:04 <sbp> nsh: Got Link™?
14:41:35 <sbp> 13:57:15 <nsh> yah
14:41:35 <sbp> 13:57:25 <nsh> http://www.bbc.co.uk/radio4/reith/historic_audio/reith_historic.shtml
14:41:37 <MoiraA> what's the subject?
14:41:42 <sbp> - http://swhack.com/logs/2007-11-07#T13-50-40
14:41:52 <sbp> the subject of the lecture?
14:41:59 <sbp> the direction of humanity, as I recall
14:42:12 <sbp> "Social cohesion and human nature."
14:42:18 <nslater> "Our live audience is a huge part of what makes the Christmas Lectures so exciting and you can be there too! Booking for the 2008 Christmas Lectures opens on Monday 1 September at 9.30am. You will be able to buy tickets online, or over the phone."
14:42:21 <MoiraA> I prefer the science ones
14:42:23 <sbp> it's entitled "Authority And The Individual"
14:42:40 <nslater> might take my little sister
14:43:01 <sbp> heh. most people torture their sisters less subtly
14:43:16 <nslater> you dont rate them then? :p
14:43:33 <sbp> I think I saw a couple televised
14:43:37 <sbp> they seemed very... strange
14:43:42 <nslater> definepls
14:43:57 <nsh> greeeko-roman
14:44:22 <sbp> well for a start, there's one I remember quite well: the lecturer was speaking way too slowly, pausing painstakingly between each sentence so that people (apparently) could note down what he was saying word for word
14:44:47 <nslater> Monty: remind me in 30 days to think about getting tickets to the RI christmas lectures
14:44:47 <Monty> nslater: Okay, I'll remind you about that on Sun Aug 17 15:44:39 BST 2008
14:44:50 <MoiraA> god how grim
14:45:05 <sbp> then there's the tenor of it all: he seemed to be trying to do that annoying thing that people do sometimes when they want to make a "boring" subject "exciting". start to get animated and wave your hands about and speak excitedly, but don't actually change the expression or content
14:45:54 <sbp> oh and slip in "trendy" references to sneakers and wristwatches and all those other strange new fangled inventions of the 20th century that lecturers seem to have missed
14:46:17 <sbp> or, more seriously, to whatever the latest flavour of the month comedy show is
14:46:18 <MoiraA> sbp my pet hate is powerpoint
14:46:26 <sbp> Tufte's too
14:47:07 <sbp> nslater: the other annoying thing was the... hmm. how to put it
14:47:19 <sbp> I think I'll describe it as middle classed intellectual sycophantism
14:47:53 <sbp> so he'd make the most tenuous of jokes and everybody would have to laugh RIOTOUSLY otherwise it just wouldn't be polite
14:48:19 <sbp> and it was clear that the lecturer was the Master, the distinguished person; the way he comported himself
14:48:39 <sbp> I dunno. it reminded me of what that guy said about President Bush lately
14:48:42 <MoiraA> lecturers who clearly only just discovered powerpoint and who are still fascinated with animated text and cash register sounds everywhere
14:48:59 <sbp> that whenever he was around Bush, Bush was always saying "you have to listen to me; I'm the President!"
14:49:22 <sbp> the guy was like, people who are really powerful in character don't *need* to keep reminded everyone around them that they're powerful
14:50:04 <sbp> my own experiences of lectures have been the same. I've seen some distinguished people speak, but some of them *acted* distinguished and some of them *were* distinguished
14:50:14 <sbp> this is a very important part, in my mind, of the enjoyment factor of a lecture
14:50:31 <nsh> "Being powerful is like being a lady: if you have to tell people you are, you aren't." -M. Thatcher
14:50:38 <jsled> heh
14:50:38 <sbp> hehe
14:50:40 <nsh> (eminant 20th century russian-american philosopher)
14:50:49 <jsled> (FISH)
14:50:49 <sbp> chuckle
14:51:40 <MoiraA> sbp: I said that to you
14:51:45 <nslater> sbp: going point, though I feel you may be mischaractising the RI lectures based on one bad experience
14:51:55 *** zachb has quit (Remote closed the connection)
14:51:55 <MoiraA> only with reference to knowledge and intelligence
14:51:57 <sbp> you said that being powerful is like being a lady?
14:52:06 <MoiraA> nsh: patronising
14:52:08 <sbp> oh right. I thought I'd chatted with someone about this recently
14:52:11 *** zachb (n=zachb@c-71-192-250-122.hsd1.ma.comcast.net) has joined #swhack
14:52:17 <nslater> I wonder if it works in reverse
14:52:18 <MoiraA> you shouldn't feel you can't say you are a lady because you are powerful
14:52:29 * nslater is a shit and worthless programmer
14:52:32 <MoiraA> it's like piers whatever on TV a few days ago
14:52:35 <sbp> nslater: sure. but it's hard to predict just from a billing
14:52:35 * nslater looks around to see if he's getting any respect
14:52:37 <MoiraA> hah
14:52:44 <MoiraA> you're not I am
14:52:49 <zachb> Yes, yes you are nslater
14:52:52 <MoiraA> you joke
14:52:53 <zachb> You get no respect
14:52:57 <MoiraA> I really am
14:53:07 <nslater> zachb: your face is non-free software
14:53:07 <zachb> No, you are a fantabulous programmer
14:53:14 <sbp> hmm
14:53:26 <sbp> we should use +v as a dunce-hat-and-sit-in-the-corner mode
14:53:27 <zachb> nslater: yeah, because if I OS'd it, the world would esplode w/ beauty!
14:53:37 <nslater> sbp, do it
14:53:43 <MoiraA> you could be crap nslater
14:53:51 <MoiraA> but I can't say that
14:53:59 <MoiraA> a) I'm worse
14:54:05 <sbp> if I did, they might notice the portal
14:54:13 <MoiraA> b) I don't know enough to know if you are or not
14:54:13 <nslater> portal?
14:54:16 <zachb> *might*
14:55:20 <sbp> nslater: http://swhack.com/logs/2008-07-16#T09-25-00
14:56:00 <nslater> schweet
14:57:04 * zachb verbs nslater
14:57:46 <nslater> ooh, hehe, got another email from Paul Ginsparg
14:57:52 <nslater> lisppaste2: pointer
14:57:54 <nslater> erm
14:57:57 <nslater> lisppaste2: url
14:57:57 <lisppaste2> To use the lisppaste bot, visit http://paste.lisp.org/new/swhack and enter your paste.
14:59:06 <lisppaste2> nslater pasted "More comments from Paul Ginsparg" at http://paste.lisp.org/display/63894
14:59:14 * nslater grins
14:59:26 <MoiraA> that is evil
14:59:34 <MoiraA> I looked at it when I was +q
14:59:45 <MoiraA> I could paste into logs
15:00:02 <MoiraA> I could paste logs here into a channel without +c set
15:00:11 <sbp> nslater: this raddens and raddens
15:00:21 <nslater> sbp, what's the law that states that laws are always coined by people other than the law's namesake? I intend to point Ginsparg to it
15:00:31 <nsh> did he explain how you misunderstood his law?
15:00:36 <nsh> because i cba to
15:00:55 <nsh> oh, he did
15:00:58 <sbp> I don't know Jeff Harvey
15:01:08 <sbp> I certainly know of Jacques Distler
15:01:16 <nsh> .wik Jacques Distler
15:01:17 <phenny> "Jacques Distler (born 1961) is a physicist currently working in string theory." - http://en.wikipedia.org/wiki/Jacques_Distler
15:01:27 <nslater> nsh, misunderstood?
15:01:27 <sbp> nslater: Stigler's Law of eponymy
15:01:32 <nslater> thanks
15:01:45 <sbp> nsh: how could he misunderstood what he hath coined?
15:02:15 <nsh> because we coined it
15:02:23 <nslater> well, this is true
15:02:30 <nsh> and nslater pfftificated it
15:02:50 <nslater> actually, I specifically asked sbp to condense it into a pithy sentence, which is where it stands today
15:02:56 <nslater> all I did was give it a URI
15:03:07 <nsh> ok
15:03:13 * nsh blames sbp nao
15:03:30 <sbp> nsh: you do better then! :-)
15:03:35 <nslater> heh
15:03:44 <nsh> it's dead to me :-/
15:03:47 <nsh> nah, i'm just messin'
15:04:04 <nsh> wtf, that paste is already a google result
15:04:09 <nsh> well, the earlier one
15:04:11 <nslater> no way
15:04:15 <sbp> the original was "That some journals and scientific institutions have low or variable standards is hardly a revelation", pretty much
15:04:20 <nslater> google must like lisppaste
15:04:34 <nslater> yeah, and the page on my site links to the original formulation, so all is kosha
15:04:46 <nsh> note, sbp you already called him on it! http://inamidst.com/stuff/q/ginsparg
15:04:53 <sbp> yeah. we basically bred that original formulation with something like Sturgeon's
15:05:01 <sbp> hehe
15:05:06 <nslater> nsh, note that sbp's complaints are out of date
15:05:14 <nsh> you're out of dates
15:05:18 <nslater> sbp has, in private correspondance, commented that my version is better XD
15:05:28 <nslater> I would provide proof, but it would blow your mind
15:05:32 <sbp> I never digitally signed that comment!
15:05:35 <nslater> heh
15:05:42 <nsh> probably because you have pictures of him with that lawn-mower in a compromising circumstance..
15:06:20 <sbp> nsh's phrasing was "any seemingly notable observation can be reformulated as a completely obvious result"
15:06:30 <nslater> yes
15:06:33 <sbp> but he was sniping
15:06:37 <nslater> nsh, put up your own page
15:06:39 <nsh> which is completely different in meaning
15:06:43 * nsh doesn't contribute to the failternet
15:06:50 <nslater> me and sbp are currently engaged in a google fight for top position
15:07:04 <nslater> and to that end, http://bytesexual.org/miscellanea/ginsparg, mwhahaha
15:07:22 <nsh> funnily enough, paste.lisp.org beats both of you
15:07:28 <sbp> aw mang
15:07:30 <nsh> in y'all's faces
15:07:33 <nslater> it depends on your search term
15:07:40 <sbp> .g "Ginsparg's Law"
15:07:41 <phenny> sbp: http://inamidst.com/stuff/q/ginsparg
15:07:48 <sbp> okay. wins
15:07:50 <nslater> .g "Ginsparg’s Law"
15:07:50 <phenny> nslater: http://bytesexual.org/miscellanea/ginsparg
15:07:51 *** d3llboy has quit (Remote closed the connection)
15:07:51 *** d3llboy_ has quit (Remote closed the connection)
15:07:57 <nslater> .g "Ginsparg Law"
15:07:58 <phenny> nslater: http://bytesexual.org/miscellanea/ginsparg
15:08:02 * nslater wins
15:08:05 <sbp> .g Ginsparg's Law
15:08:06 * nsh gets list.org for both quotes and without
15:08:08 <phenny> sbp: http://inamidst.com/stuff/q/ginsparg
15:08:12 * sbp wins
15:08:20 <nslater> we already saw that abuse of the ' character
15:08:20 <nsh> maybe fi.google is on a more recent spider cycle
15:08:28 <sbp> you're abuse of the ' character
15:08:34 <nslater> no, your face
15:08:35 <sbp> .g Ginsparg’s Law
15:08:36 <phenny> sbp: http://bytesexual.org/miscellanea/ginsparg
15:08:38 <sbp> nurface
15:08:44 <sbp> .g Ginsparg Law
15:08:45 <phenny> sbp: http://bytesexual.org/miscellanea/ginsparg
15:08:51 <sbp> darnitte
15:08:54 <nslater> WHY YOU REPEATING SEARCHES
15:09:03 <sbp> you used "s!
15:09:12 <sbp> not a single search has been repeated
15:09:21 <nslater> oh right
15:09:24 <nsh> .g ginsparg`s law
15:09:24 <phenny> nsh: http://bytesexual.org/miscellanea/ginsparg
15:09:30 <sbp> arse
15:09:34 <sbp> .g ginsparg-s law
15:09:35 <phenny> sbp: http://bytesexual.org/miscellanea/ginsparg
15:09:40 <sbp> .g ginspargs law
15:09:41 <phenny> sbp: http://www.aishdas.org/avodah/vol02/v02n168.shtml
15:09:44 <nsh> .g ginsparg¦s law
15:09:44 <phenny> nsh: http://bytesexual.org/miscellanea/ginsparg
15:09:54 <sbp> ...what?
15:09:55 <Monty> only with reference to keep reminded me and nslater
15:10:37 <nsh> wtf are they talking about on that list?!?
15:10:50 <nsh> AUTHENTICITY OF ZOHAR Y'ALL
15:11:06 <nsh> .wik gilgulim
15:11:07 <phenny> "Gilgul, Gilgul neshamot or Gilgulei Ha Neshamot (Heb. גלגול הנשמות) refers to the concept of reincarnation, emanating from the Kabbalistic framework within Judaism." - http://en.wikipedia.org/wiki/Gilgul_(Kabbalah)
15:11:46 <nsh> this is some double-industrial-rated made-up shiznizle
15:11:57 <nsh> "For lack of a better reason, maybe these were intended to be said when Rosh
15:11:57 <nsh> Chodesh fell on Shabbos. I have not looked carefully at the piyutim in a
15:11:57 <nsh> while, but maybe there is a passing reference to Rosh Chodesh. That would
15:11:57 <nsh> explain why only the Shekalim and HaChodesh get musaf piyutim.
15:11:59 <nsh> "
15:12:00 <sbp> .wik The Zohar
15:12:02 <nsh> riiiiiiiiiiiiiiiiiiiiiiight
15:12:04 <phenny> "The Zohar (Hebrew: זהר‎, lit Splendor or Radiance) is widely considered the most important work of Kabbalah, or Jewish mysticism." - http://en.wikipedia.org/wiki/The_Zohar
15:13:02 <nsh> why don't these guys just stop clinging to vestiges of legibility and just have the mailing list in ancient hebrew
15:13:07 <nsh> on clay tablets
15:13:09 <sbp> hehe
15:13:21 <nslater> what would you use as the delivery mechanism, nsh?
15:13:33 <sbp> I like this comment:
15:13:40 <sbp> "No, I have not changed my ideology one iota! I am not quitting the Agudah, nor am I joining Edah!"
15:13:41 <nslater> pigion carrier?
15:13:47 <nsh> i'd attach the tablet to one side of your mum, then tell her there's a plate of cookies that-a-way
15:13:57 <nslater> woah man harsh
15:14:02 <nsh> eek, sry
15:14:07 <nslater> http://i.cnn.net/cnn/2004/TECH/science/02/06/homing.pigeons.reut/vert.pigeon.jpg
15:14:11 <nslater> pigeons are weird
15:14:14 <nslater> (FACT)
15:14:24 * nsh forgets there are people who are still offendible
15:14:25 <sbp> he's eaten a tennis ball
15:14:43 <MoiraA> tablet to one side of nslater's mum?
15:16:37 *** d3llboy (i=d3llboy@gateway/tor/x-7ab48b6de924c098) has joined #swhack
15:16:44 *** MoiraA has quit (Remote closed the connection)
15:16:49 <nsh> d3llboy: STATE PARALLAX
15:17:06 <sbp> nsh: all the same, compare this with any of numerous threads discussing the intricacies of Christianity. there's nothing about evolution or homosexuality or the such here
15:17:07 <nsh> http://deputy-dog.com/2008/07/17/ever-seen-a-creepier-tower/
15:17:37 <nsh> sbp, i actually has a lot of time for kabbalah. but glib reaction is glib
15:17:48 *** zachb has quit (Remote closed the connection)
15:18:01 *** zachb (n=zachb@c-71-192-250-122.hsd1.ma.comcast.net) has joined #swhack
15:18:38 <nsh> now, that is some fucked up architecture
15:19:00 <nsh> [[[
15:19:00 <nsh> My reaction was "Mmm, that's an interesting looking tower and OH MY GOD WHAT THE HELL IS ON THE SIDE OF AAAAAAHHAHAHAHA!!"
15:19:00 <nsh> Then I got a close look at the last picture and something stopped working in the back of my brain. Now I can look at the pictures without reaction, but I think a tiny part of my humanity is now gone. I think I'd miss it, but I need it to miss it... So it's an odd catch 22 of losing that little bit of my soul. Thank you again, internet.
15:19:05 <nsh> ]]] - http://www.reddit.com/info/6s8ld/comments/
15:19:11 <sbp> nsh: well what interests me is that fundamentalism in the form of adherence to bizarre ancient lex scripta doesn't seem to necessarily always turn sour
15:19:22 *** d3llboy_ (i=d3llboy@gateway/tor/x-d19417d40c47dcd0) has joined #swhack
15:19:29 <sbp> which might indicate that the act in itself isn't especially pernicious
15:19:36 <sbp> it's other factors that make it so
15:19:41 *** SinDoc (n=SinDoc@88.82.49.246) has joined #swhack
15:19:45 * nsh agress
15:19:49 <nsh> agrees
15:19:55 <nsh> i was actually thinking about this the other day
15:20:29 <nsh> it takes another factor entirely to cause the negative aspects of literal adherence
15:20:34 *** Schroeder (i=1000@kntpin04-nas-02-s160.cinergycom.net) has joined #swhack
15:20:50 <nsh> something either explicitly political or a collective unconscious abreaction to some societal change
15:20:54 <Noia> ?
15:21:04 <nsh> which then takes the text as its precipition point
15:21:09 <nsh> *precipitation
15:21:20 <sbp> especially good with kaleidoscopic texts
15:21:37 * nsh stealthily looks up term
15:22:02 <sbp> I just mean texts that you can easily read anything into if you look hard enough at mere fragments
15:22:24 <nsh> ok, i guessed as much
15:22:30 <nslater> oh man, I would love it so much if I was watching some lecture with Jacques Distler at, say, the Royal Institute Christmas Lectures, and half way through he cited Ginsparg's Law
15:22:37 <nsh> for some reason i was reading kaleidoscope but my brain was thinking telescope
15:22:39 <sbp> hehe
15:22:44 <nsh> which is why i was getting confailed
15:23:24 <nsh> nslater, and then a team of swedish bikini models came out and started dancing to a power rock version of that song you wrote in primary school
15:23:31 <sbp> hahaha
15:23:47 <Morbus> hah!
15:23:47 <Morbus> nice!
15:23:48 <Morbus> http://en.wikipedia.org/wiki/John_F._Kennedy
15:23:52 <nsh> and halfway through the refrain, there is an interruption and it's announced that you've won all eleven nobel prizes half-way through the year
15:23:59 <sbp> woah
15:24:08 <nsh> that happened to me once
15:24:18 <nsh> i had to decline, for reasons of anonymity
15:24:23 <sbp> what does it say, Morbus?
15:24:30 <Morbus> no idea, jut heard of it now.
15:24:36 <Morbus> but there have been talks that the zodiac is back.
15:24:40 *** zachb has quit (Remote closed the connection)
15:24:43 <nsh> wait, there was a John *F.* Kennedy?!?
15:24:47 <sbp> lisppaste2: url?
15:24:48 <lisppaste2> To use the lisppaste bot, visit http://paste.lisp.org/new/swhack and enter your paste.
15:24:52 *** zachb (n=zachb@c-71-192-250-122.hsd1.ma.comcast.net) has joined #swhack
15:25:08 <Morbus> sbp: so you saw it? it's gone now.
15:25:09 <lisppaste2> sbp pasted "some strange thing on Wikipedia" at http://paste.lisp.org/display/63895
15:25:09 <nsh> wtfwtfwtfwtf
15:25:22 <sbp> yeah
15:25:37 *** MoiraA (n=moira@tor/regular/pdpc.supporter.active.MoiraA) has joined #swhack
15:25:42 <Morbus> apparently, it was on mckinley too http://www.google.com/search?q=%E2%80%9CThis%20is%20the%20Zodiac%20speaking.%20You%20people%20seem%20so%20smart%2C%20yet%20I%20get%20away%20with%20so%20much.%20Here%20is%20a%20letter%20for%20you%20smart%20people%3A
15:25:45 <Morbus> or maybe it was a site wide hack.
15:25:47 <nslater> what the fuck is going on
15:26:03 <nslater> woah
15:26:05 <Morbus> it may have been sitewide - i'm not seeing edit removals in the history
15:26:05 <nslater> i have it too
15:26:18 <nslater> fuckwhat
15:26:42 <nslater> its still there
15:26:45 <Morbus> not for me.
15:26:48 <lisppaste2> sbp annotated #63895 with "the source, for reference" at http://paste.lisp.org/display/63895#1
15:27:08 <nsh> .g image paste
15:27:09 <phenny> nsh: http://www.freedownloadscenter.com/Best/ocr-image-paste.html
15:27:14 <nsh> .g imagebin
15:27:15 <phenny> nsh: http://imagebin.org/
15:27:21 <Morbus> hrm. is it as simple as a webdings conversion? that'd be lame.
15:27:22 <sbp> nsh: photos.cx
15:27:22 <nslater> screenshot might be useful, which I could provide
15:27:23 <jsled> I don't see what you're talking about either.
15:27:37 <sbp> nslater: photos.cx
15:27:41 <nslater> k
15:27:51 <MoiraA> sorry disconnected
15:28:11 <sbp> Morbus: do sysop reverts show up in the history?
15:28:16 <Morbus> yeah.
15:28:45 <nsh> http://g.photos.cx/wikipedia-pwnt-bf
15:28:45 <Monty> nslater: yeah, and I can't find the such here
15:28:56 <Morbus> nsh: nothing.
15:28:59 <nsh> http://g.photos.cx/wikipedia-pwnt-bf.kpg
15:29:01 <nsh> http://g.photos.cx/wikipedia-pwnt-bf.jpg
15:30:19 <sbp> nsh: Firefox on Windows? so do you hate freedom or don't you?!
15:30:26 <nsh> don't ask.
15:30:30 <sbp> hehe
15:30:34 <Morbus> i can't find anyone else talking about this.
15:31:06 <sbp> might be a simple codepoint shift
15:31:13 <sbp> they're all in the same plane aren't they?
15:31:38 <Morbus> sbp http://hotfreshnow.blogspot.com/2008/06/zodiac-returns-or-retarded-copycat.html
15:31:51 <Morbus> i recall reading that article at nbc a bit ago.
15:32:02 <lisppaste2> sbp annotated #63895 with "codepoints" at http://paste.lisp.org/display/63895#2
15:32:16 <nslater> also, http://g.photos.cx/zodiac-7c.jpg
15:32:20 <sbp> .u fdf2
15:32:20 <phenny> U+FDF2 ARABIC LIGATURE ALLAH ISOLATED FORM (ﷲ)
15:32:44 <nsh> wtf
15:33:04 <Morbus> ""I will start using my role-model's signature," the author says in the letter, which was posted on the newspaper's Web site."
15:33:05 <Morbus> http://www.nbc17.com/midatlantic/ncn/search.apx.-content-articles-NCN-2008-06-28-0003.html
15:34:03 <nslater> argh, that site has crashed my firefox
15:34:10 * nslater bonks Morbus over the head with a badger
15:35:26 <lisppaste2> nslater annotated #63895 with "Image" at http://paste.lisp.org/display/63895#3
15:36:24 <Morbus> analyzed at ↙€☻￥€∀⊙⌂⊙☻♂ﷲ⊙⅛⊙▓々￥⊙€⊙♫♫㉿㌘†☻⊙∆⊙♫㌘†☻☻々↔∆╨€☻⅛⊙∀∀⊙☻♂▓々㉿▓∀々㉿↔╨€↙⊙☻♂♫々ⅨД々 ґ€†♫々ﷲ╨々☻☼㉿†⅛⊙∀∀▓々㉿▓∀々☼㉿†㉿☻∀☼￥々♫∆↔㉿☼∆╨々⊙↔Д㉿￥☼♫Д†∆ﷲ╨々☻☼㉿†↙€☻￥€∀⊙⌂々∆╨⊙♫ﷲ々 Д♫⊙∆々
15:36:24 <Morbus> ☼㉿†⅛⊙∀∀∆╨々♫㉿†∀㉿㌘∆╨々▓㉿㉿↔$†々々↔▓⊙♂♫∀€↙々♫∆╨€∆￥々↙㉿∆々∆╨々⊙↔∀⊙↙々♫∆㉿∆╨々々¾Д€↔⅛¾々☻∆∆╨€∆⊙€¾☻㉿ﷲ￥々♫∆↔㉿☼⊙☻♂ﷲ⊙∆╨¾☼㉿ﷲ☻Д€↔々╨€☻￥♫
15:36:26 <Morbus> whoops.
15:36:28 <nslater> lol
15:36:28 <sbp> Morbus: >>> len(set(text))
15:36:28 <Morbus> http://www.characterfrequencyanalyzer.com/english/index.php
15:36:28 <sbp> 26
15:36:30 <zachb> What are we doing?
15:36:36 <MoiraA> Morbus!
15:36:37 <sbp> Morbus: yeah, simple substitution cipher
15:36:38 <nslater> hacking
15:36:43 <zachb> Ah
15:36:44 <MoiraA> sbp would +q me if I did that
15:37:05 <Morbus> sbp: oh, fun.
15:37:07 <Morbus> i suck at cryptograms.
15:37:15 <zachb> There's cryptogram solvers out there
15:37:23 <Morbus> yeah, but in english.
15:37:27 <zachb> just replace each one w/ a letter then plug them in
15:37:27 <MoiraA> I love cryptograms
15:37:31 <Morbus> w'd have to transcode this to normal letters first.
15:37:35 * Morbus starts.
15:37:35 <zachb> Oh, why? What lang is this in?
15:37:41 <Morbus> http://g.photos.cx/zodiac-7c.jpg
15:37:41 <MoiraA> gus said the only thing I had any knowledge of on computers was encryption
15:37:42 <zachb> Write a program to do it! :P
15:37:42 <Morbus> zachb:
15:38:13 <zachb> Sorry, I jumped in
15:38:24 <zachb> I tried to read the backlog, but it just seems so random
15:38:31 <nslater> sbp: how do you know it's a subsitution cypher?
15:38:45 <Morbus> nslater: we assumed due to 26 unique chars.
15:38:46 <nslater> oh... 26
15:39:11 <nslater> looking at it by eye, I would guess the smiley to be "e" :p
15:39:25 <jsled> Well, if there's no punct, case-difference nubmers or spaces. :p
15:39:31 <zachb> I wonder if its just "This is the Zodiac speaking..."
15:39:33 <jsled> Or numbers.
15:39:36 <zachb> no, wait, doesn't match up
15:39:52 <jsled> thequickbrownfoxjumpsoverthelazyyellowdog
15:39:53 <jsled> solved.
15:40:04 <jsled> s/yellow/red/whatever/
15:40:04 <zachb> Hah
15:40:12 <zachb> Its just lazy dog
15:40:19 <jsled> WHAWEVER>
15:40:22 <zachb> thequickbrownfoxjumpedoverthelazydog
15:40:33 <zachb> zachb >>> len(set(text))
15:40:44 <zachb> Aww, I'm not privliged D;
15:40:48 <sbp> I just tried a partial substitution, but it didn't work
15:40:49 <Monty> AUTHENTICITY OF AAAAAAHHAHAHAHA!!"
15:41:04 <zachb> Heh
15:41:17 <sbp> using bigram frequencies would be best
15:41:40 <Morbus> ABCDBEFGHCIJHKHLMDHBHNNOPQCHRHNPQCCMSRTBCKHEEHCILMOLEMOSTBAHCINMUVM WBQNMJTMCXOQKHEELMOLEMXOQOCEXDMNRSOXRTMHSVODXNVQRJTMCXOQABCDBEHGMRTHNJM VNHRMXOQKHEERTMNOQEOPRTMLOOSYQMMSLHINEBAMNRTBRDMAORMRTMHSEHAMNRORTMMZVBSKZMCRRTBRHBZCOJDMNRSOXHCIJHRTZXOJCVBSMTBCDN<
15:41:40 <Monty> yes you seem to transcode this comment:
15:41:45 <Morbus> so, that's what i get when i translate.
15:41:54 <zachb> Wait
15:42:02 <zachb> I got 36 different chars
15:42:08 <Morbus> when i substitute one symbol per letter
15:42:13 <zachb> I think you're all crazy
15:43:25 <clsn> I think half of you are crazy, but which half changes frequently.
15:43:53 * clsn starts to figure it isn't that 100% of you are crazy 100% of the time, but 50% of you are crazy 200% of the time.
15:44:03 <Morbus> b;eh.
15:44:09 *** d3llboy_ has quit ()
15:44:10 <Morbus> someone else help me on this ;)
15:44:11 <zachb> Hmm
15:44:17 <zachb> Morbus: you're crazy
15:44:28 <sbp> Morbus: here it is as an alphabetic cipher:
15:44:28 <sbp> kgrzglnonrtynhnqvzngnuuwxfrnmnuxfrrvjmpgrhnllnrtqvwqlvwjpgknrtuvidvaegfuvypvrswfhnllqvwqlvswfwrlszvumjwsmpvnjdwzsudfmypvrswfkgrzglnovmpnuyvadunmvswfhnllmpvuwflwxmpvqwwjbfvvjqntulgkvumpgmzvkwmvmpvnjlnkvumwmpvvcdgjhcvrmmpgmngcrwyzvumjwsnrtynmpcswyrdgjvpgrzu
15:44:41 <Morbus> sbp: you gotta add spacers.
15:44:45 <sbp> can't!
15:44:46 <Morbus> before we can run it through a solver.
15:44:49 <zachb> clsn: and yet only 25% of you can detect the other 400%'s craziness
15:44:51 <Morbus> why?
15:44:57 <nslater> .c 26!
15:44:57 <phenny> 26 ! = 4.03291461e26
15:45:00 <sbp> if it's using 26, presumably it's the 26 letters of the alphabet
15:45:03 <zachb> sbp: what if one of those chars is a space?!
15:45:04 <sbp> no space
15:45:08 <sbp> hmm. could be
15:45:11 * clsn first read it as "here it is in alphabetical order", which is a LOT less helpful for deciphering.
15:45:21 <nslater> are there programatic substitution cypher solvers?
15:45:21 <sbp> 々 is the most common char
15:45:29 <zachb> Yes
15:45:32 <Morbus> yeah, but some twice in a row.
15:45:37 <Morbus> ㉿㉿↔$†々々↔
15:45:38 <zachb> Why don't you start out with some basic ones
15:45:52 <sbp> okay, so v is the most common
15:45:53 <nslater> i bet if you took into account the distribution of letter frequency and used the oed to look up you could do it in a lot less itterations than 4.03291461e26
15:45:58 <clsn> Start some trial substitutions and see if patterns start to pop out.
15:46:03 <sbp> 'kgrzglnonrtynhnq zngnuuwxfrnmnuxfrr jmpgrhnllnrtq wql wjpgknrtu id aegfu yp rswfhnllq wql swfwrlsz umjwsmp njdwzsudfmyp rswfkgrzglno mpnuy adunm swfhnllmp uwflwxmp qwwjbf jqntulgk umpgmz kwm mp njlnk umwmp cdgjhc rmmpgmngcrwyz umjwsnrtynmpcswyrdgj pgrzu'
15:46:10 <sbp> that doesn't look right. words are too long
15:46:16 <sbp> so I would suggest that it doesn't use spaces
15:46:23 <MoiraA> I will do it later
15:46:29 <MoiraA> got to get letter in post
15:46:31 <nslater> what is the likelyhood that all 26 letters are used though
15:46:31 <zachb> vnmwg -- those are the most frequent
15:46:33 <clsn> Aren't there programs that let you type a letter to replace what you're highlighting and it instantly goes and substitutes it all through?
15:46:42 <nslater> clsn: emacs :)
15:46:44 <Morbus> http://snicker.nebrwesleyan.edu/~mcclung/ciphers.php
15:46:59 <clsn> Nono, something easier.
15:47:01 <MoiraA> is it english?
15:47:01 <nslater> M-x replace
15:47:07 <clsn> And less level-mixing.
15:47:07 <Monty> pigion carrier?
15:47:11 <MoiraA> I have a frequency chart
15:47:11 <nslater> nu
15:47:15 <sbp> http://en.wikipedia.org/wiki/Image:English-slf.png
15:47:17 <clsn> That can keep the replaced ones separate from the unsolved...
15:47:22 * aspect gets 54 symbols
15:47:24 <MoiraA> nslater no??
15:47:35 <MoiraA> ok
15:47:42 <clsn> I think there was a "cwb" (cracker's workbench) that did something like that for simple enigma ciphers.
15:47:42 <zachb> I got 36
15:47:45 <aspect> zachb: what's going on
15:47:52 <zachb> I'm not quite sure
15:47:57 <aspect> oh wait
15:48:00 <aspect> halve my count
15:48:02 <zachb> They found some random jibberish and they're trying to figure it out
15:48:04 <zachb> Why?
15:48:12 <aspect> and I got a space from the paste
15:48:17 <MoiraA> let me upload the english frequency chart for letters anyway
15:48:21 * aspect goes quiet
15:48:23 <Morbus> zachb: well, at the very least, whoever put that crap up broke wikipedia ;0
15:48:30 <zachb> ETAOINSHRDLU!
15:48:31 <aspect> caesar says tpaipuwxwachwqwzeiwpwddfgoawvwdgoaaesvypaqwuuwaczefzuefsyptwacdermejnpodehyeabfoqwuuzefzuebfofaubiedvsfbvyewsmfibdmovhyeabfotpaipuwxevywdhejmdwvebfoqwuuvyedfoufgvyezffskoeeszwcduptedvypvietfvevyewsuwtedvfvyeelmpsqleavvypvwplafhiedvsfbwachwvylbfhampseypaid
15:48:37 <MoiraA> would help with more text
15:48:37 <aspect> hampsey paid?
15:49:01 <clsn> "paid"... hmm...
15:49:03 <zachb> http://rumkin.com/tools/cipher/frequency.php
15:49:22 <aspect> from sbp's kgrz
15:49:26 <clsn> That actually looks like it might be getting somewhere. The frequencies might be different for the small sample, but it might get some right,.
15:49:39 <aspect> /usr/games/caesar is based on etoainshrdlu IIRC
15:49:54 <sbp> hmm
15:49:59 <zachb> mmg
15:50:02 <aspect> guess: the word "zodiac" appears in there
15:50:09 <nslater> "Shakespeare invented the words assassination" - wtf
15:50:14 <zachb> You guys are distracting me from work
15:50:24 <MoiraA> quit zachb
15:50:27 * zachb hmphs
15:50:31 <MoiraA> do we have even one letter?
15:50:42 <sbp> presumably v in my cipher is actually e
15:50:46 <MoiraA> oh crap I really must finish a letter to orange
15:50:47 <MoiraA> ok
15:50:47 <sbp> since it's the most common
15:51:00 <Morbus> aspect: there's no six letter word with unique characters.
15:51:01 *** zachb has quit (Remote closed the connection)
15:51:01 <nslater> lol
15:51:06 <clsn> How do you enter something into http://rumkin.com/tools/cipher/frequency.php ?
15:51:16 <Morbus> i'm using http://snicker.nebrwesleyan.edu/~mcclung/getCipher.html
15:51:20 <Morbus> with kgrzglnonrtynhnq zngnuuwxfrnmnuxfrr jmpgrhnllnrtq wql wjpgknrtu id aegfu yp rswfhnllq wql swfwrlsz umjwsmp njdwzsudfmyp rswfkgrzglno mpnuy adunm swfhnllmp uwflwxmp qwwjbf jqntulgk umpgmz kwm mp njlnk umwmp cdgjhc rmmpgmngcrwyz umjwsnrtynmpcswyrdgj pgrzu
15:51:20 <aspect> there's not a good candidate for space?
15:51:34 <clsn> I guess "New Cipher" at the bottom...
15:51:44 <clsn> If I were writing something like this, I probably would leave out spaces anyway.
15:52:09 <aspect> Morbus: no 6-letter unique sequence? how did you determine this out of interest?
15:52:10 <nslater> there is no v
15:52:19 * aspect actually more interested in the tools than the solution :)
15:52:20 <Morbus> aspect: i looked at sbp's attempt with spaces.
15:52:30 <MoiraA> so fill in all Es
15:52:36 <MoiraA> look at the neighbouring letters
15:52:40 <MoiraA> can we get them
15:52:51 <aspect> oh, not what I thought you meant :)
15:53:00 <Morbus> so, #wikipedia suggests that template modification could have futz Kennedy and Mckinley.
15:53:07 <Morbus> so you guys work on the cypher, and i'll track down shared templates ;)
15:53:13 *** zachb (n=zachb@c-71-192-250-122.hsd1.ma.comcast.net) has joined #swhack
15:53:21 <zachb> fucking pidgin/skype!
15:53:23 <nsh> http://en.wikipedia.org/w/index.php?title=Template%3AMulti-video_end&diff=226457998&oldid=226455545
15:53:36 <Morbus> nsh: woot.
15:53:41 <Morbus> nsh: how'd you find that?
15:53:42 <nsh> 67.174.28.61.unassigned.static.eastern-tele.com
15:53:44 <zachb> loggy: uri?
15:53:44 <loggy> http://swhack.com/logs/2008-07-18#T15-53-44
15:53:56 <nsh> Morbus, someone in #wikimedia found it
15:54:05 <nslater> sbp, how did you assign spaces?
15:54:15 <nslater> in the text you pasted?
15:54:23 * nsh was ---><--- close though [maybe]
15:54:49 <sbp> map the most frequent character to space
15:55:03 <Morbus> vandaljzingwikipediaissofunitisfunnerthankillingpeopleorhavingsexbecausewhenyoukillpeopleyouonlydestroytheirbodysbutwhenyouvandalizethiswebsiteyoukillthesoulofthepoorqueerpigslavesthatdevotetheirlivestotheembarkmentthatiamnowdestroyingwithmyownbarehands
15:55:14 <zachb> Wow, was that it?
15:55:14 <lisppaste2> sbp annotated #63895 with "bigram frequency" at http://paste.lisp.org/display/63895#4
15:55:22 <sbp> cf. http://en.wikipedia.org/wiki/Bigram
15:55:26 <clsn> hello... that looks readable...
15:55:28 <zachb> Good job everyone
15:55:32 <sbp> Morbus: ah! well done
15:55:37 <sbp> how'd you get that?
15:55:37 <nsh> edit was from philipines
15:55:38 <nslater> Morbus: how did you get that?
15:55:44 <zachb> Vandalizing wikipedia is so fun it is funner than killing people or having sex
15:55:53 <clsn> neat.
15:55:59 <MoiraA> sbp you stole my thunder
15:56:02 <zachb> because when you kill people you only destroy their bodys but when you vandalize this website you kill the soul
15:56:08 <jsled> Morbus: nice.
15:56:14 *** Noia has quit (Excess Flood)
15:56:20 * MoiraA was pasting letter frequency for English language
15:56:23 <Morbus> vandaljzing wikipedia is so fun it is funner than killing people or having sex because when you kill people you only destroy their bodys but when you vandalize this website you kill the soul of the poor queer pig slaves that devote their lives to the embarkment that i am now destroying with my own bare hands
15:56:31 *** Noia (n=none@host-84-9-196-58.dslgb.com) has joined #swhack
15:56:32 *** Noia has quit (Excess Flood)
15:56:33 <zachb> of the poor queer pig slaves that devote their lives to the embarkment that I am now destroying with my own bare hands
15:56:35 <Morbus> [11:55] <ianivs_> Number of keys checked: 6395041
15:56:35 <Morbus> [11:55] <kkaefer> ianivs_: nicely done
15:56:35 <Morbus> [11:55] <ianivs_> ran it through a tool :)
15:56:40 <Morbus> old workbuddies :)
15:56:41 <sbp> heh
15:56:45 <zachb> Heh, that was quick
15:56:47 <Morbus> working off sbp's original transcoding.
15:56:49 *** Noia (n=none@host-84-9-196-58.dslgb.com) has joined #swhack
15:56:50 *** Noia has quit (Excess Flood)
15:56:52 <sbp> sweet
15:56:58 <jsled> that was fast.
15:57:07 *** Noia (n=none@unaffiliated/noia) has joined #swhack
15:57:07 <zachb> bigrams == good
15:57:08 *** Noia has quit (Excess Flood)
15:57:15 <nslater> wow
15:57:47 <MoiraA> ah man
15:57:53 <MoiraA> I was doing well with cryptool
15:57:55 * Morbus writes blog post.
15:58:00 <MoiraA> I want another
15:58:07 <MoiraA> when I come back from post office
15:58:18 <clsn> "embarkment"?
15:58:23 <aspect> so what's the key?
15:58:35 <aspect> oh wait
15:58:36 <sbp> from (7, 'pv'), (10, 'mp') and the Bigrams table, I would've worked out m -> t, p -> h, and v -> e confirmed
15:58:39 <aspect> that's kind of poitless
15:58:48 <sbp> aspect: yes, since the original was in unicode
15:59:00 <sbp> unicodigook
15:59:00 <nsh> we got decoded?
15:59:09 <MoiraA> you are too fast sbp
15:59:09 *** Noia (n=none@host-84-9-196-58.dslgb.com) has joined #swhack
15:59:10 *** Noia has quit (Excess Flood)
15:59:13 <nsh> http://en.wikipedia.org/wiki/Special:Contributions/61.28.174.67 (hit 6 templates)
15:59:19 * nsh wonders how many articles that covers
15:59:22 <MoiraA> I love these, but I take much longer
15:59:28 <MoiraA> sbp I have a puzzle for you
16:00:01 <sbp> 61.28.174.67 comes up on lots of proxy lists
16:00:56 *** mmmmmrob_ has quit (Read error: 110 (Connection timed out))
16:02:01 <sbp> http://en.wikipedia.org/wiki/User_talk:61.28.174.67 - heh
16:02:27 <zachb> heh
16:02:49 <zachb> We should encode something using his cypher and post it on his talk
16:02:59 <sbp> hehe
16:03:02 <zachb> like "youareafuckingmoronleaveusaloneyoudidntdoanydamage"
16:03:32 <zachb> "onlywussiesuseproxies"
16:03:57 <MoiraA> cant find it
16:04:08 <MoiraA> sbp will look later
16:04:17 <MoiraA> you haven't had Netcat in the Hat from me have you?
16:05:24 <Tene> http://www.asofterworld.com/index.php?id=325
16:05:32 <sbp> [[[
16:05:33 <sbp> Pig Slave
16:05:33 <sbp> In "Daleks in Manhattan" and "Evolution of the Daleks" (2007), the Cult of Skaro experiments on humans and turn them into Pig Slaves if they present a low level of intelligence. Just why the Daleks chose such a form for their slaves is unknown.
16:05:40 <sbp> ]]] - http://en.wikipedia.org/wiki/List_of_Doctor_Who_monsters_and_aliens
16:05:50 <nsh> loggy, pointer?
16:05:50 <loggy> http://swhack.com/logs/2008-07-18#T16-05-50
16:05:52 <sbp> and given the -ize endings, we'll surmise an American Doctor Who fan?
16:06:50 <zachb> Wha?
16:06:53 <zachb> Oh
16:07:15 <nsh> btw... http://61.28.174.67/ gives apache test page
16:07:30 <sbp> nsh: pretty sure it's an open proxy
16:07:44 <sbp> see http://www.google.com/search?q=61.28.174.67
16:08:05 <nsh> .head http://61.28.174.67/
16:08:08 <phenny> nsh: 403, text/html, UTF-8, 3931 bytes
16:08:14 <nsh> .head SERVER http://61.28.174.67/
16:08:14 <phenny> Can't connect to SERVER
16:08:27 <nsh> .head http://61.28.174.67/ HTTP-SERVER
16:08:28 <zachb> .head body
16:08:28 <phenny> Can't connect to body
16:08:30 <phenny> There was no HTTP-SERVER header in the response.
16:08:35 <zachb> .head Monty
16:08:35 <phenny> Can't connect to Monty
16:08:36 <Monty> woos
16:08:38 <Monty> pubic lice's rails specialises in SNES CowBot.
16:11:32 <Morbus> http://www.disobey.com/node/1837
16:11:33 <nsh> ah well, that was fun
16:11:38 <Morbus> still working on it/ anything to add?
16:11:48 *** martiancode (n=martiani@unaffiliated/martiancode) has joined #swhack
16:13:08 <Morbus> i used whoever's screenshot that was, so please check it over to make sure there's nothing secrit in there you don't want.
16:13:20 <nslater> only that nsh is a freedom hating nazi
16:13:26 <lisppaste2> sbp pasted "Subject: Vandalism Using Your Open Proxy" at http://paste.lisp.org/display/63897
16:13:27 <nsh> no problem, Morbus
16:13:52 <zachb> Gasp! They use windoze!
16:13:53 <nsh> well played, sbp
16:14:14 <zachb> Sounds good, sbp
16:14:34 <Morbus> so, what's going on with the IP find?
16:14:57 <sbp> I emailed the technical support for the maintainer of the proxy running on that IP
16:15:22 <nsh> 15:45, 18 July 2008 Thatcher (Talk | contribs) blocked "61.28.174.67 (Talk)" (account creation blocked) with an expiry time of 3 years ? ({{blockedproxy}})
16:15:30 <sbp> heh, ouch
16:15:33 <lisppaste2> MoiraA pasted "Netcat in the Hat" at http://paste.lisp.org/display/63898
16:15:48 <clsn> WP is still gebusted.
16:15:57 <MoiraA> did I already give you that sbp?
16:15:59 <MoiraA> do try it
16:16:04 <sbp> can't remember you doing so
16:16:09 <sbp> clsn: how so?
16:16:22 <MoiraA> I love it because if you're old enough to remember the Cat in the Hat books, it's really cleverly written
16:16:28 *** libby has quit (Read error: 113 (No route to host))
16:16:29 *** Noia (n=none@unaffiliated/noia) has joined #swhack
16:16:30 <Monty> lo Noia
16:17:16 <clsn> Just went to look at "Deconstruction" and it's still Zodiacked.
16:17:26 <zachb> link?
16:17:32 <nslater> http://en.wikipedia.org/wiki/Deconstruction
16:17:36 <Morbus> not for me.
16:17:38 <nslater> not for me
16:17:51 <nsh> wtf at the pic for that article!
16:18:03 <clsn> I only just opened it, so maybe it was just fixed or somehow I got a cache.
16:18:23 <jsled> WTF at the caption for that pic
16:18:28 <sbp> the caption is... right
16:18:36 <nsh> "Deconstruction is the process of reducing things to their component entities, and examining their assumptions. Here, the New Haven Coliseum sports arena is deconstructed into its component entities, which a Judeo-Christian might find to be topologically homeomorphic to ash and dust particles, illustrating the Judeo-Christian concept of ashes to ashes, dust to dust. However, a Buddhist might see the coliseum reincarnating into an ethereal cloud, and a Zen Buddhist
16:18:38 <nsh> yeah...
16:18:56 <nslater> the image is gone now
16:18:58 <nslater> wtf
16:18:59 <Morbus> same
16:19:23 <nslater> http://en.wikipedia.org/w/index.php?title=Deconstruction&diff=226469860&oldid=226469288
16:19:33 * nsh doubts this snark was related
16:19:35 <zachb> http://en.wikipedia.org/w/index.php?title=Deconstruction&oldid=226447107 ?
16:20:32 <zachb> .
16:20:36 <sbp> http://en.wikipedia.org/w/index.php?title=Deconstruction&diff=226442565&oldid=226431685
16:20:40 <sbp> that's the original change
16:20:56 <sbp> by http://en.wikipedia.org/wiki/User:Brhaspati
16:21:13 *** nslater changed the topic to: "First there was a Swhack. Then it blew up."
16:22:29 *** zachb changed the topic to: "First there was a Swhack. Then nslater blew it up."
16:22:43 <nslater> : : : ( ( (
16:22:52 <zachb> )))
16:22:54 <zachb> much better!
16:23:07 <sbp> you didn't preserve spacing
16:23:13 <nslater> sorry
16:23:20 <sbp> no, zachb
16:23:24 <zachb> Wait, did I zwnbsp!?
16:23:40 <sbp> you should've said ) ) ), not )))
16:23:40 <nslater> haha
16:23:44 <nslater> http://en.wikipedia.org/wiki/User_talk:Sleepsong
16:23:49 <zachb> So? Who cares?
16:23:51 <nslater> [[[
16:23:52 <nslater> Deconstruction
16:23:52 <nslater> Aww, you're no fun! :-D Seriously though, I'm surprised my edit lasted only 24 minutes. -- Brhaspati\talk/contribs 14:56, 18 July 2008 (UTC)
16:23:55 <nslater> I'm sooooooo sorry! I really hated to do it, because yours was the most creative edit of the day, but... Argh, couldn't stand Wikipedia turning into Uncyclopedia. I swear, one of these days Jimmy Wales and Larry Sanger are going to show up at Randall's apartment and shoot him. Then they're going to play in the ball pit. Sleepsong (talk) 15:08, 18 July 2008 (UTC)
16:24:00 <nslater> ]]]
16:24:03 <sbp> hehe
16:24:06 <zachb> Ahaha
16:24:24 <sbp> see http://xkcd.com/451/
16:25:02 <nslater> hahaha
16:25:32 <zachb> Fuck
16:25:37 <zachb> That was clever
16:25:41 <sbp> the mouseover text of which is "If you think this is too hard on literary criticism, read the Wikipedia article on deconstruction."
16:25:53 <clsn> Which is how I got there, duh.
16:25:55 * nsh smiles
16:25:55 <sbp> which is presumably ho... right
16:26:02 <Morbus> sbp, i emailed Loren about it. he had already remarked on the zodiac letter purportedly sent
16:26:04 <Morbus> http://copycateffect.blogspot.com/
16:26:06 <clsn> That's why I mentioned it in the first place. I happened to be looking at xkcd. :)
16:26:07 <nslater> there is a section on xkcd in http://en.wikipedia.org/wiki/Talk:Deconstruction
16:26:08 <nsh> clsn, did [[Deconstruction]] have the zodiac message?
16:26:08 <sbp> Morbus: ha
16:26:15 <clsn> It did when I looked at it.
16:26:19 <nsh> because it doesn't directly transclude any of the affected templates
16:26:26 <nsh> but it might transclude a template that does
16:26:38 <sbp> [[[
16:26:38 <sbp> How clueless are you? You'd have to be pretty stupid not to realize the picture was a joke. "Perhaps it was added by a jokester?" Do you really need a "perhaps"? If its not obvious to you you're a moron. —Preceding unsigned comment added by 72.80.165.218 (talk) 15:26, 18 July 2008 (UTC)
16:26:39 <sbp> ]]]
16:26:50 <Morbus> where's that?
16:26:54 <nslater> ditto
16:27:03 <zachb> Talk page
16:27:04 <nslater> aha
16:27:07 <nslater> "Picture"
16:27:07 <Morbus> on what?
16:27:13 <nslater> http://en.wikipedia.org/wiki/Talk:Deconstruction
16:27:40 <Morbus> ahhhh.